PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G35110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 368aa    MW: 40633.9 Da    PI: 11.5825
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G35110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.7e-07210258147
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47 
                      r +W++ Ed+ +  a  + + +   +W+++a+ ++ gRt+ +  +++q +
  OMERI01G35110.1 210 RRPWSKVEDKVFESALVLCPEDvpdRWALVAAQLP-GRTPQEALEHYQVL 258
                      679********************************.******99999975 PP

2Myb_DNA-binding39.61.2e-12301345347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W+++E+ l++++  ++G g+W+ I+r    +Rt+ q+ s+ qky
  OMERI01G35110.1 301 PWSEDEHRLFLEGLDRYGRGDWRNISRFSVRTRTPTQVASHAQKY 345
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.0E-6209261IPR001005SANT/Myb domain
SuperFamilySSF466897.48E-10209258IPR009057Homeodomain-like
PfamPF002498.0E-6210257IPR001005SANT/Myb domain
PROSITE profilePS500906.47210259IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-5210257IPR009057Homeodomain-like
CDDcd001672.94E-5213259No hitNo description
PROSITE profilePS5129418.866294350IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-9295350IPR009057Homeodomain-like
SuperFamilySSF466892.02E-16296350IPR009057Homeodomain-like
SMARTSM007173.3E-10298348IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.9E-16298349IPR006447Myb domain, plants
CDDcd001674.61E-10301346No hitNo description
PfamPF002493.0E-10301345IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MKQTTTHRKT LRAQTNSTRI PESSGKQPRP RATPPPLPAD GRSALRARVH RPWRRPCARK  60
GYAPMAHGPA ASHPTARPKR VRPRGQSITK NPHGIPNPPF HSLELHPVIH LTRAVPTPKR  120
NLYKFRFPRA AAANQGQQHT APPAHPSTHP PAHATPSSSL VAAVACRTSH RDRPCLCRPR  180
EGTERLGGRG GDSLGMDLYG VAAGGGPAAR RPWSKVEDKV FESALVLCPE DVPDRWALVA  240
AQLPGRTPQE ALEHYQVLVA DIDLIMRGAV DAPGSWDDND GNDRRGGGGK PRGEERRRGV  300
PWSEDEHRLF LEGLDRYGRG DWRNISRFSV RTRTPTQVAS HAQKYFIRQA NAGARDSKRK  360
SIHDITTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-15211300990RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0036110.0AP003611.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423B08.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0CAN60.0A0A0E0CAN6_9ORYZ; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.18e-42MYB family protein